SCOPe 2.08: Domain d2vola1: 2vol A:237-341

Lineage for d2vola1 (2vol A:237-341)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d2vola1: 2vol A:237-341 [304552]
   Other proteins in same PDB: d2volb1, d2volb2
   automated match to d3hkfa1
   protein/DNA complex; protein/RNA complex; complexed with fuc

Details for d2vola1

PDB Entry: 2vol, 1.95 Å

PDB Description: Murine TRIM21 in Complex with Murine IgG Fc

PDB Compounds: (A:) murine igg fc

SCOPe Domain Sequences for d2vola1:

Sequence; same for both SEQRES and ATOM records:

>d2vola1 b.1.1.2 (A:237-341) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vssvfifppkpkdvltitltpkvtcvvvdiskddpevqfswfvddvevhtaqtkpreeqf
nstfrsvselpimhqdwlngkefkcrvnsaafpapiektisktkg

Timeline for d2vola1:

• d2vola1 first appeared in SCOPe 2.06
  
• d2vola1 appears in SCOPe 2.07