Lineage for d2vjgd_ (2vjg D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582438Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2582439Protein automated matches [190218] (22 species)
    not a true protein
  7. 2582519Species Carrot (Daucus carota) [TaxId:4039] [311246] (1 PDB entry)
  8. 2582523Domain d2vjgd_: 2vjg D: [304550]
    automated match to d3ie5a_
    complexed with edo, p4c, peg, pg4, pge

Details for d2vjgd_

PDB Entry: 2vjg (more details), 2.7 Å

PDB Description: crystal structure of the major carrot allergen dau c 1
PDB Compounds: (D:) major allergen dau c 1

SCOPe Domain Sequences for d2vjgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjgd_ d.129.3.0 (D:) automated matches {Carrot (Daucus carota) [TaxId: 4039]}
aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
kgdavvpeenikfadaqntalfkaieaylian

SCOPe Domain Coordinates for d2vjgd_:

Click to download the PDB-style file with coordinates for d2vjgd_.
(The format of our PDB-style files is described here.)

Timeline for d2vjgd_: