![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
![]() | Protein automated matches [190218] (22 species) not a true protein |
![]() | Species Carrot (Daucus carota) [TaxId:4039] [311246] (1 PDB entry) |
![]() | Domain d2vjgc_: 2vjg C: [304549] automated match to d3ie5a_ complexed with edo, p4c, peg, pg4, pge |
PDB Entry: 2vjg (more details), 2.7 Å
SCOPe Domain Sequences for d2vjgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vjgc_ d.129.3.0 (C:) automated matches {Carrot (Daucus carota) [TaxId: 4039]} aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht kgdavvpeenikfadaqntalfkaieaylian
Timeline for d2vjgc_: