Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (22 species) not a true protein |
Species Carrot (Daucus carota) [TaxId:4039] [311246] (1 PDB entry) |
Domain d2vjga_: 2vjg A: [304547] automated match to d3ie5a_ complexed with edo, p4c, peg, pg4, pge |
PDB Entry: 2vjg (more details), 2.7 Å
SCOPe Domain Sequences for d2vjga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vjga_ d.129.3.0 (A:) automated matches {Carrot (Daucus carota) [TaxId: 4039]} aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht kgdavvpeenikfadaqntalfkaieaylian
Timeline for d2vjga_: