Lineage for d2veja_ (2vej A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211684Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)
  6. 2211694Protein Isopentenyl diphosphate isomerase [64370] (2 species)
  7. 2211695Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
    Uniprot Q46822
  8. 2211723Domain d2veja_: 2vej A: [304536]
    automated match to d1ppva_
    complexed with mn

Details for d2veja_

PDB Entry: 2vej (more details), 2.2 Å

PDB Description: monoclinic form of idi-1
PDB Compounds: (A:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d2veja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2veja_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft

SCOPe Domain Coordinates for d2veja_:

Click to download the PDB-style file with coordinates for d2veja_.
(The format of our PDB-style files is described here.)

Timeline for d2veja_: