Lineage for d2vehb1 (2veh B:4-182)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577867Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2577868Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2578224Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)
  6. 2578234Protein Isopentenyl diphosphate isomerase [64370] (2 species)
  7. 2578235Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
    Uniprot Q46822
  8. 2578252Domain d2vehb1: 2veh B:4-182 [304534]
    Other proteins in same PDB: d2vehb2
    automated match to d1ppvb_
    complexed with ded, mg, mn

Details for d2vehb1

PDB Entry: 2veh (more details), 2.19 Å

PDB Description: monoclinic form of idi-1
PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d2vehb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vehb1 d.113.1.2 (B:4-182) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk

SCOPe Domain Coordinates for d2vehb1:

Click to download the PDB-style file with coordinates for d2vehb1.
(The format of our PDB-style files is described here.)

Timeline for d2vehb1: