Lineage for d2ve0a3 (2ve0 A:300-493)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367979Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2367980Protein automated matches [190824] (23 species)
    not a true protein
  7. 2368120Species Coriolopsis gallica [TaxId:76126] [256171] (9 PDB entries)
  8. 2368144Domain d2ve0a3: 2ve0 A:300-493 [304533]
    automated match to d2hrga3
    complexed with cu1, nag

Details for d2ve0a3

PDB Entry: 2ve0 (more details), 2.3 Å

PDB Description: coriolopsis gallica laccase t2 copper depleted
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d2ve0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ve0a3 b.6.1.0 (A:300-493) automated matches {Coriolopsis gallica [TaxId: 76126]}
vesalttltavpvpgkptpggvdlalnmafgnggnftingasftpptvpvllqilsgaqs
aqdllpsgsvyslpanadieislpaasaafphpfhlhghtfavvrsagsstynyanpvyr
dvvstgspgdnvtirfrtdnpgpwflhchidfhleagfavvmaedipdvaatnpvpqaws
dlcptydalspddq

SCOPe Domain Coordinates for d2ve0a3:

Click to download the PDB-style file with coordinates for d2ve0a3.
(The format of our PDB-style files is described here.)

Timeline for d2ve0a3: