![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Coriolopsis gallica [TaxId:76126] [256171] (9 PDB entries) |
![]() | Domain d2ve0a2: 2ve0 A:131-299 [304532] automated match to d2hrga2 complexed with cu1, nag |
PDB Entry: 2ve0 (more details), 2.3 Å
SCOPe Domain Sequences for d2ve0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ve0a2 b.6.1.0 (A:131-299) automated matches {Coriolopsis gallica [TaxId: 76126]} dphkslydvdddstvitladwyhlaakvgaavptadatlinglgrsistlnadlavitvt kgkryrfrlvslscdpnhtfsidghsltvieadsvnlkpqtvdsiqifaaqrysfvlnad qdvdnywiralpnsgtrnfaggvnsailrydgaapveptttqtpstrpl
Timeline for d2ve0a2: