Lineage for d2vdza3 (2vdz A:300-496)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772380Species Coriolopsis gallica [TaxId:76126] [256171] (9 PDB entries)
  8. 2772383Domain d2vdza3: 2vdz A:300-496 [304530]
    automated match to d4a2ea3
    complexed with cu

Details for d2vdza3

PDB Entry: 2vdz (more details), 1.7 Å

PDB Description: crystal structure of a coriolopsis gallica laccase at 1.7 a resolution
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d2vdza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdza3 b.6.1.0 (A:300-496) automated matches {Coriolopsis gallica [TaxId: 76126]}
vesalttlkgtaapgsptpggvdlalnmafgfaggnftingasftpptvpvllqilsgaq
saadllpagsvyslpanadieislpataaapgfphpfhlhghvfavvrsagsstynyanp
vyrdvvstgapgdnvtirfrtdnpgpwflhchidfhleagfavvmaedipdvaatnpvpq
awsdlcptydalspddq

SCOPe Domain Coordinates for d2vdza3:

Click to download the PDB-style file with coordinates for d2vdza3.
(The format of our PDB-style files is described here.)

Timeline for d2vdza3: