Lineage for d2vdsa1 (2vds A:1-130)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772380Species Coriolopsis gallica [TaxId:76126] [256171] (9 PDB entries)
  8. 2772396Domain d2vdsa1: 2vds A:1-130 [304525]
    automated match to d4a2ea1
    complexed with cu, cu1, cu3, nag

Details for d2vdsa1

PDB Entry: 2vds (more details), 2.3 Å

PDB Description: crystal structure of laccase from coriolopsis gallica
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d2vdsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdsa1 b.6.1.0 (A:1-130) automated matches {Coriolopsis gallica [TaxId: 76126]}
aigpvadltisngavspdgfsrqailvndvfpsplitgnkgdrfqlnvidnmtnhtmlks
tsihwhgffqhgtnwadgpafvnqcpistghaflydfqvpdqagtfwyhshlstqycdgl
rgpivvydpd

SCOPe Domain Coordinates for d2vdsa1:

Click to download the PDB-style file with coordinates for d2vdsa1.
(The format of our PDB-style files is described here.)

Timeline for d2vdsa1: