SCOPe 2.08: Domain d2vcrh2: 2vcr H:81-222

Lineage for d2vcrh2 (2vcr H:81-222)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)

8. Domain d2vcrh2: 2vcr H:81-222 [304523]
   Other proteins in same PDB: d2vcra1, d2vcrb1, d2vcrc1, d2vcrd1, d2vcre1, d2vcrf1, d2vcrg1, d2vcrh1
   automated match to d2vcta2
   complexed with gsw

Details for d2vcrh2

PDB Entry: 2vcr, 2.2 Å

PDB Description: glutathione transferase a2-2 in complex with glutathione

PDB Compounds: (H:) glutathione s-transferase a2

SCOPe Domain Sequences for d2vcrh2:

Sequence; same for both SEQRES and ATOM records:

>d2vcrh2 a.45.1.1 (H:81-222) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikekalidmyiegiadlgemilllpftqpeeqdaklaliqektknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleesrkifrf

Timeline for d2vcrh2:

• d2vcrh2 first appeared in SCOPe 2.06
  
• d2vcrh2 appears in SCOPe 2.07