Lineage for d1gra_2 (1gra 166-290)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 388822Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 388823Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 389137Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (12 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 389198Protein Glutathione reductase [51944] (3 species)
  7. 389216Species Human (Homo sapiens) [TaxId:9606] [51945] (17 PDB entries)
  8. 389226Domain d1gra_2: 1gra 166-290 [30452]
    Other proteins in same PDB: d1gra_3
    complexed with fad, gsh, ndp

Details for d1gra_2

PDB Entry: 1gra (more details), 2 Å

PDB Description: substrate binding and catalysis by glutathione reductase as derived from refined enzyme: substrate crystal structures at 2 angstroms resolution

SCOP Domain Sequences for d1gra_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gra_2 c.3.1.5 (166-290) Glutathione reductase {Human (Homo sapiens)}
sqipgaslgitsdgffqleelpgrsvivgagyiavemagilsalgsktslmirhdkvlrs
fdsmistncteelenagvevlkfsqvkevkktlsglevsmvtavpgrlpvmtmipdvdcl
lwaig

SCOP Domain Coordinates for d1gra_2:

Click to download the PDB-style file with coordinates for d1gra_2.
(The format of our PDB-style files is described here.)

Timeline for d1gra_2: