![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein automated matches [226848] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries) |
![]() | Domain d2vcrd2: 2vcr D:81-222 [304515] Other proteins in same PDB: d2vcra1, d2vcrb1, d2vcrc1, d2vcrd1, d2vcre1, d2vcrf1, d2vcrg1, d2vcrh1 automated match to d2vcta2 complexed with gsw |
PDB Entry: 2vcr (more details), 2.2 Å
SCOPe Domain Sequences for d2vcrd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcrd2 a.45.1.1 (D:81-222) automated matches {Human (Homo sapiens) [TaxId: 9606]} lygkdikekalidmyiegiadlgemilllpftqpeeqdaklaliqektknryfpafekvl kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp gsprkppmdeksleesrkifrf
Timeline for d2vcrd2: