SCOPe 2.08: Domain d2vcrc1: 2vcr C:2-80

Lineage for d2vcrc1 (2vcr C:2-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d2vcrc1: 2vcr C:2-80 [304512]
   Other proteins in same PDB: d2vcra2, d2vcrb2, d2vcrc2, d2vcrd2, d2vcre2, d2vcrf2, d2vcrg2, d2vcrh2
   automated match to d2vcta1
   complexed with gsw

Details for d2vcrc1

PDB Entry: 2vcr, 2.2 Å

PDB Description: glutathione transferase a2-2 in complex with glutathione

PDB Compounds: (C:) glutathione s-transferase a2

SCOPe Domain Sequences for d2vcrc1:

Sequence; same for both SEQRES and ATOM records:

>d2vcrc1 c.47.1.0 (C:2-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aekpklhysnirgrmesirwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

Timeline for d2vcrc1:

• d2vcrc1 first appeared in SCOPe 2.06
  
• d2vcrc1 appears in SCOPe 2.07