Lineage for d2v9ha2 (2v9h A:92-174)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012169Fold d.391: POlypeptide TRansport Associated (PORTRA) domain-like [310567] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; mixed beta sheet, order 132
  4. 3012170Superfamily d.391.1: POlypeptide TRansport Associated (PORTRA) domain-like [310598] (2 families) (S)
    Pfam PF07244
  5. 3012171Family d.391.1.1: POlypeptide TRansport Associated (PORTRA) domain [310646] (3 proteins)
  6. 3012189Protein automated matches [310860] (1 species)
    not a true protein
  7. 3012190Species Escherichia coli [TaxId:562] [311245] (1 PDB entry)
  8. 3012192Domain d2v9ha2: 2v9h A:92-174 [304503]
    automated match to d2qcza2

Details for d2v9ha2

PDB Entry: 2v9h (more details)

PDB Description: solution structure of an escherichia coli yaet tandem potra domain
PDB Compounds: (A:) Outer membrane protein assembly factor yaeT

SCOPe Domain Sequences for d2v9ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9ha2 d.391.1.1 (A:92-174) automated matches {Escherichia coli [TaxId: 562]}
ptiasitfsgnksvkddmlkqnleasgvrvgesldrttiadiekgledfyysvgkysasv
kavvtplprnrvdlklvfqegvs

SCOPe Domain Coordinates for d2v9ha2:

Click to download the PDB-style file with coordinates for d2v9ha2.
(The format of our PDB-style files is described here.)

Timeline for d2v9ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v9ha1