SCOPe 2.06: Domain d2v44a2: 2v44 A:114-207

Lineage for d2v44a2 (2v44 A:114-207)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d2v44a2: 2v44 A:114-207 [304494]
   automated match to d2xy2a2
   complexed with gol

Details for d2v44a2

PDB Entry: 2v44, 1.77 Å

PDB Description: crystal structure of ncam2 ig1-2

PDB Compounds: (A:) Neural cell adhesion molecule 2

SCOPe Domain Sequences for d2v44a2:

Sequence, based on SEQRES records:

>d2v44a2 b.1.1.0 (A:114-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kltfrevvspqefkqgedaevvcrvssspapavswlyhneevttisdnrfamlannnlqi
lninksdegiyrcegrveargeidfrdiivivnv

Sequence, based on observed residues (ATOM records):

>d2v44a2 b.1.1.0 (A:114-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kltfrevvspqefkqgedaevvcrvssspapavswlyhnvttisdnrfamlannnlqiln
inksdegiyrcegrveargeidfrdiivivnv

Timeline for d2v44a2:

• d2v44a2 is new in SCOPe 2.06-stable
  
• d2v44a2 appears in SCOPe 2.07
  
• d2v44a2 appears in the current release, SCOPe 2.08