Lineage for d2v44a1 (2v44 A:19-113)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2355461Domain d2v44a1: 2v44 A:19-113 [304493]
    automated match to d2xy2a1
    complexed with gol

Details for d2v44a1

PDB Entry: 2v44 (more details), 1.77 Å

PDB Description: crystal structure of ncam2 ig1-2
PDB Compounds: (A:) Neural cell adhesion molecule 2

SCOPe Domain Sequences for d2v44a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v44a1 b.1.1.0 (A:19-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
allqvtislskvelsvgeskfftctaigepesidwynpqgekiistqrvvvqkegvrsrl
tiynaniedagiyrcqatdakgqtqeatvvleiyq

SCOPe Domain Coordinates for d2v44a1:

Click to download the PDB-style file with coordinates for d2v44a1.
(The format of our PDB-style files is described here.)

Timeline for d2v44a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v44a2