Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d2v44a1: 2v44 A:19-113 [304493] automated match to d2xy2a1 complexed with gol |
PDB Entry: 2v44 (more details), 1.77 Å
SCOPe Domain Sequences for d2v44a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v44a1 b.1.1.0 (A:19-113) automated matches {Human (Homo sapiens) [TaxId: 9606]} allqvtislskvelsvgeskfftctaigepesidwynpqgekiistqrvvvqkegvrsrl tiynaniedagiyrcqatdakgqtqeatvvleiyq
Timeline for d2v44a1: