SCOPe 2.07: Domain d2rr4a1: 2rr4 A:246-307

Lineage for d2rr4a1 (2rr4 A:246-307)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.2: CW-type zinc finger [310596] (1 family)
   Pfam PF07496
   Binds only one zinc; similarity and possible homology to PHD domains noted in PubMed 20826339

5. Family g.50.2.1: CW-type zinc finger [310644] (2 proteins)

6. Protein zf-CW and PWWP domain containing protein 1 (ZCWPW1) [310787] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311044] (2 PDB entries)

8. Domain d2rr4a1: 2rr4 A:246-307 [304473]
   Other proteins in same PDB: d2rr4a2
   complexed with zn

Details for d2rr4a1

PDB Entry: 2rr4

PDB Description: Complex structure of the zf-CW domain and the H3K4me3 peptide

PDB Compounds: (A:) Zinc finger CW-type PWWP domain protein 1

SCOPe Domain Sequences for d2rr4a1:

Sequence; same for both SEQRES and ATOM records:

>d2rr4a1 g.50.2.1 (A:246-307) zf-CW and PWWP domain containing protein 1 (ZCWPW1) {Human (Homo sapiens) [TaxId: 9606]}
eisgfgqclvwvqcsfpncgkwrrlcgnidpsvlpdnwscdqntdvqynrcdipeetwtg
le

Timeline for d2rr4a1:

• d2rr4a1 first appeared in SCOPe 2.06