Lineage for d2rr4a1 (2rr4 A:246-307)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3038020Superfamily g.50.2: CW-type zinc finger [310596] (1 family) (S)
    Pfam PF07496
    Binds only one zinc; similarity and possible homology to PHD domains noted in PubMed 20826339
  5. 3038021Family g.50.2.1: CW-type zinc finger [310644] (2 proteins)
  6. 3038025Protein zf-CW and PWWP domain containing protein 1 (ZCWPW1) [310787] (1 species)
  7. 3038026Species Human (Homo sapiens) [TaxId:9606] [311044] (2 PDB entries)
  8. 3038027Domain d2rr4a1: 2rr4 A:246-307 [304473]
    Other proteins in same PDB: d2rr4a2
    complexed with zn

Details for d2rr4a1

PDB Entry: 2rr4 (more details)

PDB Description: Complex structure of the zf-CW domain and the H3K4me3 peptide
PDB Compounds: (A:) Zinc finger CW-type PWWP domain protein 1

SCOPe Domain Sequences for d2rr4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rr4a1 g.50.2.1 (A:246-307) zf-CW and PWWP domain containing protein 1 (ZCWPW1) {Human (Homo sapiens) [TaxId: 9606]}
eisgfgqclvwvqcsfpncgkwrrlcgnidpsvlpdnwscdqntdvqynrcdipeetwtg
le

SCOPe Domain Coordinates for d2rr4a1:

Click to download the PDB-style file with coordinates for d2rr4a1.
(The format of our PDB-style files is described here.)

Timeline for d2rr4a1: