SCOPe 2.07: Domain d2rkwb3: 2rkw B:351-457

Lineage for d2rkwb3 (2rkw B:351-457)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (17 species)
   not a true protein

7. Species Methanosarcina mazei [TaxId:2209] [311243] (3 PDB entries)

8. Domain d2rkwb3: 2rkw B:351-457 [304467]
   Other proteins in same PDB: d2rkwa1, d2rkwb1, d2rkwb2
   automated match to d3j9tb3
   mutant

Details for d2rkwb3

PDB Entry: 2rkw, 2.81 Å

PDB Description: intermediate position of atp on its trail to the binding pocket inside the subunit b mutant r416w of the energy converter a1ao atp synthase

PDB Compounds: (B:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d2rkwb3:

Sequence; same for both SEQRES and ATOM records:

>d2rkwb3 a.69.1.0 (B:351-457) automated matches {Methanosarcina mazei [TaxId: 2209]}
mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk
fvrqgwnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahr

Timeline for d2rkwb3:

• d2rkwb3 first appeared in SCOPe 2.06
  
• d2rkwb3 appears in the current release, SCOPe 2.08