Lineage for d2rkwb1 (2rkw B:10-75)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408138Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2408357Family b.49.1.0: automated matches [254232] (1 protein)
    not a true family
  6. 2408358Protein automated matches [254527] (17 species)
    not a true protein
  7. 2408469Species Methanosarcina mazei [TaxId:2209] [311241] (3 PDB entries)
  8. 2408474Domain d2rkwb1: 2rkw B:10-75 [304465]
    Other proteins in same PDB: d2rkwa1, d2rkwa2, d2rkwb2, d2rkwb3
    automated match to d3j9tb1
    mutant

Details for d2rkwb1

PDB Entry: 2rkw (more details), 2.81 Å

PDB Description: intermediate position of atp on its trail to the binding pocket inside the subunit b mutant r416w of the energy converter a1ao atp synthase
PDB Compounds: (B:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d2rkwb1:

Sequence, based on SEQRES records: (download)

>d2rkwb1 b.49.1.0 (B:10-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
qiagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgv
iftget

Sequence, based on observed residues (ATOM records): (download)

>d2rkwb1 b.49.1.0 (B:10-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
qiagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfeftget

SCOPe Domain Coordinates for d2rkwb1:

Click to download the PDB-style file with coordinates for d2rkwb1.
(The format of our PDB-style files is described here.)

Timeline for d2rkwb1: