| Class b: All beta proteins [48724] (177 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
| Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
| Protein automated matches [254527] (11 species) not a true protein |
| Species Methanosarcina mazei [TaxId:2209] [311241] (3 PDB entries) |
| Domain d2rkwb1: 2rkw B:10-75 [304465] Other proteins in same PDB: d2rkwa1, d2rkwa2, d2rkwb2, d2rkwb3 automated match to d3j9tb1 mutant |
PDB Entry: 2rkw (more details), 2.81 Å
SCOPe Domain Sequences for d2rkwb1:
Sequence, based on SEQRES records: (download)
>d2rkwb1 b.49.1.0 (B:10-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
qiagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgv
iftget
>d2rkwb1 b.49.1.0 (B:10-75) automated matches {Methanosarcina mazei [TaxId: 2209]}
qiagplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfeftget
Timeline for d2rkwb1: