| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) ![]() |
| Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
| Protein automated matches [254528] (11 species) not a true protein |
| Species Methanosarcina mazei [TaxId:2209] [311243] (3 PDB entries) |
| Domain d2rkwa2: 2rkw A:351-457 [304464] Other proteins in same PDB: d2rkwa1, d2rkwb1, d2rkwb2 automated match to d3j9tb3 mutant |
PDB Entry: 2rkw (more details), 2.81 Å
SCOPe Domain Sequences for d2rkwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rkwa2 a.69.1.0 (A:351-457) automated matches {Methanosarcina mazei [TaxId: 2209]}
mnsgigagktredhkavsdqmyagyaegrdlrglvaivgkealserdtkflefadlfedk
fvrqgwnenrtiedtleigwqilthlpenqlgridnkyiqkyhpahr
Timeline for d2rkwa2: