Lineage for d2rioa_ (2rio A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543618Protein Endoribonuclease Ire1 [310779] (1 species)
    Pfam PF06478; Includes extra C-terminal alpha-helical KEN domain described in PubMed 18191223
  7. 2543619Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311035] (1 PDB entry)
  8. 2543620Domain d2rioa_: 2rio A: [304460]
    complexed with adp, mg, sr

Details for d2rioa_

PDB Entry: 2rio (more details), 2.4 Å

PDB Description: structure of the dual enzyme ire1 reveals the basis for catalysis and regulation of non-conventional splicing
PDB Compounds: (A:) Serine/threonine-protein kinase/endoribonuclease IRE1

SCOPe Domain Sequences for d2rioa_:

Sequence, based on SEQRES records: (download)

>d2rioa_ d.144.1.7 (A:) Endoribonuclease Ire1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nfeqslknlvvsekilgygssgtvvfqgsfqgrpvavkrmlidfcdialmeiklltesdd
hpnviryycsettdrflyialelcnlnlqdlvesknvsdenlklqkeynpisllrqiasg
vahlhslkiihrdlkpqnilvstssrftadqqtgaenlrilisdfglckkldsgqssfrt
nlnnpsgtsgwrapelleesnnlqtkrrltrsidifsmgcvfyyilskgkhpfgdkysre
sniirgifsldemkclhdrsliaeatdlisqmidhdplkrptamkvlrhplfwpkskkle
fllkvsdrleienrdppsallmkfdagsdfvipsgdwtvkfdktfmdnleryrkyhsskl
mdllralrnkyhhfmdlpediaelmgpvpdgfydyftkrfpnlligvymivkenlsddqi
lreflys

Sequence, based on observed residues (ATOM records): (download)

>d2rioa_ d.144.1.7 (A:) Endoribonuclease Ire1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nfeqslknlvvsekilgygssgtvvfqgsfqgrpvavkrmlidfcdialmeiklltesdd
hpnviryycsettdrflyialelcnlnlqdlveskynpisllrqiasgvahlhslkiihr
dlkpqnilvstssrftadqqtgaenlrilisdfglckkldstsgwrapelleesnnlqtk
rrltrsidifsmgcvfyyilskgkhpfgdkysresniirgifsldemkclhdrsliaeat
dlisqmidhdplkrptamkvlrhplfwpkskklefllkvsdrleienrdppsallmkfda
gsdfvipsgdwtvkfdktfmdrkyhssklmdllralrnkyhhfmdlpediaelmgpvpdg
fydyftkrfpnlligvymivkenlsddqilreflys

SCOPe Domain Coordinates for d2rioa_:

Click to download the PDB-style file with coordinates for d2rioa_.
(The format of our PDB-style files is described here.)

Timeline for d2rioa_: