SCOPe 2.07: Domain d2r2ob_: 2r2o B:

Lineage for d2r2ob_ (2r2o B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.10: Rho GTPase binding domain [310659] (3 proteins)
   Pfam PF08337

6. Protein Plexin-B1 [310822] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311089] (2 PDB entries)

8. Domain d2r2ob_: 2r2o B: [304453]
   complexed with unx

Details for d2r2ob_

PDB Entry: 2r2o, 2 Å

PDB Description: crystal structure of the effector domain of human plexin b1

PDB Compounds: (B:) Plexin-B1

SCOPe Domain Sequences for d2r2ob_:

Sequence, based on SEQRES records:

>d2r2ob_ d.15.1.10 (B:) Plexin-B1 {Human (Homo sapiens) [TaxId: 9606]}
yrpltlnallavgpgageaqgvpvkvldcdtisqakekmldqlykgvpltqrpdprtldv
ewrsgvaghlilsdedvtsevqglwrrlntlqhykvpdgatvalvpc

Sequence, based on observed residues (ATOM records):

>d2r2ob_ d.15.1.10 (B:) Plexin-B1 {Human (Homo sapiens) [TaxId: 9606]}
yrpltlnallavgpaqgvpvkvldcdtisqakekmldqlykgvpltqrpdprtldvewrs
gvaghlilsdedvtsevqglwrrlntlqhykvpdgatvalvpc

Timeline for d2r2ob_:

• d2r2ob_ first appeared in SCOPe 2.06
  
• d2r2ob_ appears in the current release, SCOPe 2.08