![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.10: Rho GTPase binding domain [310659] (3 proteins) Pfam PF08337 |
![]() | Protein Plexin-B1 [310822] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311089] (2 PDB entries) |
![]() | Domain d2r2ob_: 2r2o B: [304453] complexed with unx |
PDB Entry: 2r2o (more details), 2 Å
SCOPe Domain Sequences for d2r2ob_:
Sequence, based on SEQRES records: (download)
>d2r2ob_ d.15.1.10 (B:) Plexin-B1 {Human (Homo sapiens) [TaxId: 9606]} yrpltlnallavgpgageaqgvpvkvldcdtisqakekmldqlykgvpltqrpdprtldv ewrsgvaghlilsdedvtsevqglwrrlntlqhykvpdgatvalvpc
>d2r2ob_ d.15.1.10 (B:) Plexin-B1 {Human (Homo sapiens) [TaxId: 9606]} yrpltlnallavgpaqgvpvkvldcdtisqakekmldqlykgvpltqrpdprtldvewrs gvaghlilsdedvtsevqglwrrlntlqhykvpdgatvalvpc
Timeline for d2r2ob_: