Lineage for d2qxad_ (2qxa D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2767926Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2767927Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2767928Species Human (Homo sapiens) [TaxId:9606] [49420] (71 PDB entries)
  8. 2767957Domain d2qxad_: 2qxa D: [304442]
    automated match to d4kvpc_
    complexed with zn; mutant

Details for d2qxad_

PDB Entry: 2qxa (more details), 1.5 Å

PDB Description: Human p53 Core Domain Mutant V157F
PDB Compounds: (D:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2qxad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qxad_ b.2.5.2 (D:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rframaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenl

SCOPe Domain Coordinates for d2qxad_:

Click to download the PDB-style file with coordinates for d2qxad_.
(The format of our PDB-style files is described here.)

Timeline for d2qxad_: