SCOPe 2.07: Domain d2qmja4: 2qmj A:732-868

Lineage for d2qmja4 (2qmj A:732-868)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
   sandwich; 10 strands in two sheets

4. Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families)

5. Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins)

6. Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain [310754] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311009] (3 PDB entries)

8. Domain d2qmja4: 2qmj A:732-868 [304430]
   Other proteins in same PDB: d2qmja1, d2qmja2, d2qmja3, d2qmja5
   automated match to d2qlya4
   complexed with acr, gol, nag, so4

Details for d2qmja4

PDB Entry: 2qmj, 1.9 Å

PDB Description: crystral structure of the n-terminal subunit of human maltase- glucoamylase in complex with acarbose

PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d2qmja4:

Sequence, based on SEQRES records:

>d2qmja4 b.150.1.1 (A:732-868) N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsptvtydsnlkva
iitdidlllgeaytvew

Sequence, based on observed residues (ATOM records):

>d2qmja4 b.150.1.1 (A:732-868) N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpstsptvtydsnlkvai
itdidlllgeaytvew

Timeline for d2qmja4:

• d2qmja4 first appeared in SCOPe 2.06
  
• d2qmja4 appears in the current release, SCOPe 2.08