Lineage for d2qmja4 (2qmj A:732-868)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077892Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2077893Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2077894Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 protein domains)
  6. 2077903Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain [310754] (1 species)
  7. 2077904Species Human (Homo sapiens) [TaxId:9606] [311009] (3 PDB entries)
  8. 2077905Domain d2qmja4: 2qmj A:732-868 [304430]
    Other proteins in same PDB: d2qmja1, d2qmja2, d2qmja3, d2qmja5
    automated match to d2qlya4
    complexed with acr, gol, nag, so4

Details for d2qmja4

PDB Entry: 2qmj (more details), 1.9 Å

PDB Description: Crystral Structure of the N-terminal Subunit of Human Maltase-Glucoamylase in Complex with Acarbose
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d2qmja4:

Sequence, based on SEQRES records: (download)

>d2qmja4 b.150.1.1 (A:732-868) N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsptvtydsnlkva
iitdidlllgeaytvew

Sequence, based on observed residues (ATOM records): (download)

>d2qmja4 b.150.1.1 (A:732-868) N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpstsptvtydsnlkvai
itdidlllgeaytvew

SCOPe Domain Coordinates for d2qmja4:

Click to download the PDB-style file with coordinates for d2qmja4.
(The format of our PDB-style files is described here.)

Timeline for d2qmja4:

  • d2qmja4 is new in SCOPe 2.06-stable