Lineage for d2qmja3 (2qmj A:650-731)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810903Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins)
  6. 2810929Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), domain 3 [310752] (1 species)
  7. 2810930Species Human (Homo sapiens) [TaxId:9606] [311007] (3 PDB entries)
  8. 2810931Domain d2qmja3: 2qmj A:650-731 [304429]
    Other proteins in same PDB: d2qmja1, d2qmja2, d2qmja4, d2qmja5
    automated match to d2qlya3
    complexed with gol, nag, so4

Details for d2qmja3

PDB Entry: 2qmj (more details), 1.9 Å

PDB Description: crystral structure of the n-terminal subunit of human maltase- glucoamylase in complex with acarbose
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d2qmja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmja3 b.71.1.4 (A:650-731) N-terminal subunit of Maltase-glucoamylase (NtMGAM), domain 3 {Human (Homo sapiens) [TaxId: 9606]}
tvarpllhefyednstwdvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqv
rwrkqkvemelpgdkiglhlrg

SCOPe Domain Coordinates for d2qmja3:

Click to download the PDB-style file with coordinates for d2qmja3.
(The format of our PDB-style files is described here.)

Timeline for d2qmja3: