Lineage for d2qmja2 (2qmj A:270-649)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083644Family c.1.8.13: Glycosyl hydrolase family 31 catalytic domain [117372] (5 protein domains)
    Pfam PF01055
  6. 2083656Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), catalytic domain [310750] (1 species)
  7. 2083657Species Human (Homo sapiens) [TaxId:9606] [311005] (3 PDB entries)
  8. 2083658Domain d2qmja2: 2qmj A:270-649 [304428]
    Other proteins in same PDB: d2qmja1, d2qmja3, d2qmja4, d2qmja5
    automated match to d2qlya2
    complexed with acr, gol, nag, so4

Details for d2qmja2

PDB Entry: 2qmj (more details), 1.9 Å

PDB Description: Crystral Structure of the N-terminal Subunit of Human Maltase-Glucoamylase in Complex with Acarbose
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d2qmja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmja2 c.1.8.13 (A:270-649) N-terminal subunit of Maltase-glucoamylase (NtMGAM), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
peqvvqeyleligrpalpsywalgfhlsryeygtldnmrevvernraaqlpydvqhadid
ymderrdftydsvdfkgfpefvnelhnngqklviivdpaisnnsssskpygpydrgsdmk
iwvnssdgvtpligevwpgqtvfpdytnpncavwwtkefelfhnqvefdgiwidmnevsn
fvdgsvsgcstnnlnnppftprildgylfcktlcmdavqhwgkqydihnlygysmavata
eaaktvfpnkrsfiltrstfagsgkfaahwlgdntatwddlrwsipgvlefnlfgipmvg
pdicgfaldtpeelcrrwmqlgafypfsrnhngqgykdqdpasfgadslllnssrhylni
rytllpylytlffrahsrgd

SCOPe Domain Coordinates for d2qmja2:

Click to download the PDB-style file with coordinates for d2qmja2.
(The format of our PDB-style files is described here.)

Timeline for d2qmja2:

  • d2qmja2 is new in SCOPe 2.06-stable