| Class b: All beta proteins [48724] (178 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (4 proteins) Pfam PF16863 |
| Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), N-terminal domain [310748] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [311003] (3 PDB entries) |
| Domain d2qmja1: 2qmj A:7-269 [304427] Other proteins in same PDB: d2qmja2, d2qmja3, d2qmja4, d2qmja5 automated match to d2qlya1 complexed with acr, gol, nag, so4 |
PDB Entry: 2qmj (more details), 1.9 Å
SCOPe Domain Sequences for d2qmja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qmja1 b.30.5.11 (A:7-269) N-terminal subunit of Maltase-glucoamylase (NtMGAM), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvntnagft
arlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfsgnaaas
ltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvyglgehvhq
qyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsnamevvlq
papaityrtiggildfyvflgnt
Timeline for d2qmja1:
View in 3DDomains from same chain: (mouse over for more information) d2qmja2, d2qmja3, d2qmja4, d2qmja5 |