SCOPe 2.07: Domain d2qmja1: 2qmj A:7-269

Lineage for d2qmja1 (2qmj A:7-269)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (4 proteins)
   Pfam PF16863

6. Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), N-terminal domain [310748] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311003] (3 PDB entries)

8. Domain d2qmja1: 2qmj A:7-269 [304427]
   Other proteins in same PDB: d2qmja2, d2qmja3, d2qmja4, d2qmja5
   automated match to d2qlya1
   complexed with acr, gol, nag, so4

Details for d2qmja1

PDB Entry: 2qmj, 1.9 Å

PDB Description: crystral structure of the n-terminal subunit of human maltase- glucoamylase in complex with acarbose

PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d2qmja1:

Sequence; same for both SEQRES and ATOM records:

>d2qmja1 b.30.5.11 (A:7-269) N-terminal subunit of Maltase-glucoamylase (NtMGAM), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvntnagft
arlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfsgnaaas
ltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvyglgehvhq
qyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsnamevvlq
papaityrtiggildfyvflgnt

Timeline for d2qmja1:

• d2qmja1 first appeared in SCOPe 2.06
  
• d2qmja1 appears in the current release, SCOPe 2.08