Lineage for d2qlya4 (2qly A:732-868)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089028Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2089029Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2089030Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins)
  6. 2089039Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain [310754] (1 species)
  7. 2089040Species Human (Homo sapiens) [TaxId:9606] [311009] (3 PDB entries)
  8. 2089042Domain d2qlya4: 2qly A:732-868 [304425]
    Other proteins in same PDB: d2qlya1, d2qlya2, d2qlya3, d2qlya5
    complexed with gol, nag

Details for d2qlya4

PDB Entry: 2qly (more details), 2 Å

PDB Description: crystral structure of the n-terminal subunit of human maltase- glucoamylase
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d2qlya4:

Sequence, based on SEQRES records: (download)

>d2qlya4 b.150.1.1 (A:732-868) N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsptvtydsnlkva
iitdidlllgeaytvew

Sequence, based on observed residues (ATOM records): (download)

>d2qlya4 b.150.1.1 (A:732-868) N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpstsptvtydsnlkvai
itdidlllgeaytvew

SCOPe Domain Coordinates for d2qlya4:

Click to download the PDB-style file with coordinates for d2qlya4.
(The format of our PDB-style files is described here.)

Timeline for d2qlya4: