SCOPe 2.06: Domain d2qlya4: 2qly A:732-868

Lineage for d2qlya4 (2qly A:732-868)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
   sandwich; 10 strands in two sheets

4. Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families)

5. Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins)

6. Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain [310754] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311009] (3 PDB entries)

8. Domain d2qlya4: 2qly A:732-868 [304425]
   Other proteins in same PDB: d2qlya1, d2qlya2, d2qlya3, d2qlya5
   complexed with gol, nag

Details for d2qlya4

PDB Entry: 2qly, 2 Å

PDB Description: crystral structure of the n-terminal subunit of human maltase- glucoamylase

PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d2qlya4:

Sequence, based on SEQRES records:

>d2qlya4 b.150.1.1 (A:732-868) N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpsqtsptvtydsnlkva
iitdidlllgeaytvew

Sequence, based on observed residues (ATOM records):

>d2qlya4 b.150.1.1 (A:732-868) N-terminal subunit of Maltase-glucoamylase (NtMGAM), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gyifptqqpntttlasrknplgliialdenkeakgelfwddgetkdtvankvyllcefsv
tqnrlevnisqstykdpnnlafneikilgteepsnvtvkhngvpstsptvtydsnlkvai
itdidlllgeaytvew

Timeline for d2qlya4:

• d2qlya4 is new in SCOPe 2.06-stable
  
• d2qlya4 appears in SCOPe 2.07
  
• d2qlya4 appears in the current release, SCOPe 2.08