SCOPe 2.06: Domain d2qlya3: 2qly A:650-731

Lineage for d2qlya3 (2qly A:650-731)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (3 proteins)

6. Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), domain 3 [310752] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [311007] (3 PDB entries)

8. Domain d2qlya3: 2qly A:650-731 [304424]
   Other proteins in same PDB: d2qlya1, d2qlya2, d2qlya4, d2qlya5
   complexed with gol, nag

Details for d2qlya3

PDB Entry: 2qly, 2 Å

PDB Description: crystral structure of the n-terminal subunit of human maltase- glucoamylase

PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d2qlya3:

Sequence; same for both SEQRES and ATOM records:

>d2qlya3 b.71.1.4 (A:650-731) N-terminal subunit of Maltase-glucoamylase (NtMGAM), domain 3 {Human (Homo sapiens) [TaxId: 9606]}
tvarpllhefyednstwdvhqqflwgpgllitpvldegaekvmayvpdavwydyetgsqv
rwrkqkvemelpgdkiglhlrg

Timeline for d2qlya3:

• d2qlya3 is new in SCOPe 2.06-stable
  
• d2qlya3 appears in SCOPe 2.07
  
• d2qlya3 appears in the current release, SCOPe 2.08