Lineage for d2qlya1 (2qly A:7-269)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2782059Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (5 proteins)
    Pfam PF16863
  6. 2782088Protein N-terminal subunit of Maltase-glucoamylase (NtMGAM), N-terminal domain [310748] (1 species)
  7. 2782089Species Human (Homo sapiens) [TaxId:9606] [311003] (3 PDB entries)
  8. 2782091Domain d2qlya1: 2qly A:7-269 [304422]
    Other proteins in same PDB: d2qlya2, d2qlya3, d2qlya4, d2qlya5
    complexed with gol, nag

Details for d2qlya1

PDB Entry: 2qly (more details), 2 Å

PDB Description: crystral structure of the n-terminal subunit of human maltase- glucoamylase
PDB Compounds: (A:) Maltase-glucoamylase, intestinal

SCOPe Domain Sequences for d2qlya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qlya1 b.30.5.11 (A:7-269) N-terminal subunit of Maltase-glucoamylase (NtMGAM), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vnelerincipdqpptkatcdqrgccwnpqgavsvpwcyysknhsyhvegnlvntnagft
arlknlpsspvfgsnvdnvlltaeyqtsnrfhfkltdqtnnrfevphehvqsfsgnaaas
ltyqveisrqpfsikvtrrsnnrvlfdssigpllfadqflqlstrlpstnvyglgehvhq
qyrhdmnwktwpifnrdttpngngtnlygaqtfflcledasglsfgvflmnsnamevvlq
papaityrtiggildfyvflgnt

SCOPe Domain Coordinates for d2qlya1:

Click to download the PDB-style file with coordinates for d2qlya1.
(The format of our PDB-style files is described here.)

Timeline for d2qlya1: