![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
![]() | Protein automated matches [190438] (36 species) not a true protein |
![]() | Species Dengue virus [TaxId:12637] [311239] (1 PDB entry) |
![]() | Domain d2qida_: 2qid A: [304418] Other proteins in same PDB: d2qidc_ automated match to d3e90b_ |
PDB Entry: 2qid (more details), 2.1 Å
SCOPe Domain Sequences for d2qida_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qida_ b.47.1.0 (A:) automated matches {Dengue virus [TaxId: 12637]} wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd
Timeline for d2qida_: