SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2qhgf_ (2qhg F:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011697Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2011698Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2011703Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 protein domains)
    automatically mapped to Pfam PF00068
  6. 2012068Protein automated matches [190139] (25 species)
    not a true protein
  7. 2012202Species Saw-scaled viper (Echis carinatus) [TaxId:40353] [188231] (4 PDB entries)
  8. 2012211Domain d2qhgf_: 2qhg F: [304415]
    automated match to d2qhea_
    complexed with svr

Details for d2qhgf_

PDB Entry: 2qhg (more details), 2.3 Å

PDB Description: Crystal structure of ecarpholin S (Ser49-PLA2) complexed with suramin
PDB Compounds: (F:) phospholipase a2

SCOPe Domain Sequences for d2qhgf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qhgf_ a.133.1.2 (F:) automated matches {Saw-scaled viper (Echis carinatus) [TaxId: 40353]}
svvelgkmiiqetgkspfpsytsygcfcgggergppldatdrcclahsccydtlpdcspk
tdrykykrengeiicenstsckkricecdkavavclrknlntynkkytyypnfwckgdie
kc

SCOPe Domain Coordinates for d2qhgf_:

Click to download the PDB-style file with coordinates for d2qhgf_.
(The format of our PDB-style files is described here.)

Timeline for d2qhgf_:

  • d2qhgf_ is new in SCOPe 2.06-stable