Lineage for d2qhgb_ (2qhg B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733488Species Saw-scaled viper (Echis carinatus) [TaxId:40353] [188231] (4 PDB entries)
  8. 2733490Domain d2qhgb_: 2qhg B: [304411]
    automated match to d2qhea_
    complexed with svr

Details for d2qhgb_

PDB Entry: 2qhg (more details), 2.3 Å

PDB Description: Crystal structure of ecarpholin S (Ser49-PLA2) complexed with suramin
PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d2qhgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qhgb_ a.133.1.2 (B:) automated matches {Saw-scaled viper (Echis carinatus) [TaxId: 40353]}
svvelgkmiiqetgkspfpsytsygcfcgggergppldatdrcclahsccydtlpdcspk
tdrykykrengeiicenstsckkricecdkavavclrknlntynkkytyypnfwckgdie
kc

SCOPe Domain Coordinates for d2qhgb_:

Click to download the PDB-style file with coordinates for d2qhgb_.
(The format of our PDB-style files is described here.)

Timeline for d2qhgb_: