Lineage for d2qh7a_ (2qh7 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039055Fold g.97: Iron-sulfur cluster-binding zinc finger CDGSH type [310565] (1 superfamily)
    Fe-S binding region and beta cap
  4. 3039056Superfamily g.97.1: Iron-sulfur cluster-binding zinc finger CDGSH type [310593] (2 families) (S)
    Pfam PF09360; PubMed 17766440
  5. 3039057Family g.97.1.1: Outer mitochondrial membrane protein mitoNEET-like [310640] (2 proteins)
  6. 3039058Protein mitoNEET [310780] (1 species)
  7. 3039059Species Human (Homo sapiens) [TaxId:9606] [311036] (1 PDB entry)
  8. 3039060Domain d2qh7a_: 2qh7 A: [304408]
    complexed with fes

Details for d2qh7a_

PDB Entry: 2qh7 (more details), 1.5 Å

PDB Description: mitoneet is a uniquely folded 2fe-2s outer mitochondrial membrane protein stabilized by pioglitazone
PDB Compounds: (A:) Zinc finger CDGSH-type domain 1

SCOPe Domain Sequences for d2qh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qh7a_ g.97.1.1 (A:) mitoNEET {Human (Homo sapiens) [TaxId: 9606]}
kaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgahtkhneetgdnvgpl
iikkk

SCOPe Domain Coordinates for d2qh7a_:

Click to download the PDB-style file with coordinates for d2qh7a_.
(The format of our PDB-style files is described here.)

Timeline for d2qh7a_:

3039060
d2qh7a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2qh7b_