Lineage for d2qgna_ (2qgn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113886Family c.37.1.26: Adenosine phosphateisopentenyltransferase (IPT)-like [310655] (1 protein)
  6. 2113887Protein Adenosine phosphateisopentenyltransferase (IPT) [310818] (3 species)
  7. 2113896Species Bacillus halodurans C-125 [TaxId:272558] [311085] (1 PDB entry)
  8. 2113897Domain d2qgna_: 2qgn A: [304407]
    complexed with so4

Details for d2qgna_

PDB Entry: 2qgn (more details), 2.4 Å

PDB Description: crystal structure of trna isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
PDB Compounds: (A:) tRNA delta(2)-isopentenylpyrophosphate transferase

SCOPe Domain Sequences for d2qgna_:

Sequence, based on SEQRES records: (download)

>d2qgna_ c.37.1.26 (A:) Adenosine phosphateisopentenyltransferase (IPT) {Bacillus halodurans C-125 [TaxId: 272558]}
keklvaivgptavgktktsvmlakrlngevisgdsmqvyrgmdigtakitaeemdgvphh
lidikdpsesfsvadfqdlatpliteihergrlpflvggtglyvnavihqfnlgdirade
dyrheleafvnsygvqalhdklskidpkaaaaihpnnyrrviraleiikltgktvteqar
heeetpspynlvmigltmerdvlydrinrrvdqmveeglideakklydrgirdcqsvqai
gykemydyldgnvtleeaidtlkrnsrryakrqltwfrnkanvtwfdmtdvdfdkkimei
hnfiagkleeksk

Sequence, based on observed residues (ATOM records): (download)

>d2qgna_ c.37.1.26 (A:) Adenosine phosphateisopentenyltransferase (IPT) {Bacillus halodurans C-125 [TaxId: 272558]}
keklvaivgptavgktktsvmlakrlngevisgdsmqvyrgmdigtakitaeemdgvphh
lidikdpsesfsvadfqdlatpliteihergrlpflvggtglyvnavihqfnlgetpspy
nlvmigltmerdvlydrinrrvdqmveeglideakklydrgirdcqsvqaigykemydyl
dgnvtleeaidtlkrnsrryakrqltwfrnkanvtwfdmtdvdfdkkimeihnfiagkle
eksk

SCOPe Domain Coordinates for d2qgna_:

Click to download the PDB-style file with coordinates for d2qgna_.
(The format of our PDB-style files is described here.)

Timeline for d2qgna_:

  • d2qgna_ is new in SCOPe 2.06-stable