SCOPe 2.08: Domain d2pzoa_: 2pzo A:

Lineage for d2pzoa_ (2pzo A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.10: Cap-Gly domain [74924] (2 families)

5. Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
   Pfam PF01302

6. Protein Dynactin 1 [141234] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141235] (9 PDB entries)
   Uniprot Q14203 1-99! Uniprot Q14203 25-98

8. Domain d2pzoa_: 2pzo A: [304391]
   automated match to d2hkna_
   complexed with zn

Details for d2pzoa_

PDB Entry: 2pzo, 2.6 Å

PDB Description: Crystal structure of the zinc-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly domain of human Dynactin-1 (p150-Glued)

PDB Compounds: (A:) Dynactin-1

SCOPe Domain Sequences for d2pzoa_:

Sequence; same for both SEQRES and ATOM records:

>d2pzoa_ b.34.10.1 (A:) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
plrvgsrvevigkghrgtvayvgatlfatgkwvgvildeakgkndgtvqgrkyftcdegh
gifvrqsqiqvf

Timeline for d2pzoa_:

• d2pzoa_ first appeared in SCOPe 2.06
  
• d2pzoa_ appears in SCOPe 2.07