SCOPe 2.07: Domain d2pz2a4: 2pz2 A:61-181

Lineage for d2pz2a4 (2pz2 A:61-181)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158559] (9 PDB entries)

8. Domain d2pz2a4: 2pz2 A:61-181 [304385]
   Other proteins in same PDB: d2pz2a3
   automated match to d3umsa1
   complexed with gdp, so4; mutant

Details for d2pz2a4

PDB Entry: 2pz2, 2.6 Å

PDB Description: Crystal structure of the GDP-bound conformation of a G-alpha-i1 mutant with enhanced GTPase activity

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2pz2a4:

Sequence; same for both SEQRES and ATOM records:

>d2pz2a4 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d2pz2a4:

• d2pz2a4 first appeared in SCOPe 2.06
  
• d2pz2a4 appears in the current release, SCOPe 2.08