Lineage for d2pjkc_ (2pjk C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890232Family c.57.1.0: automated matches [191349] (1 protein)
    not a true family
  6. 2890233Protein automated matches [190284] (9 species)
    not a true protein
  7. 2890268Species Sulfolobus tokodaii [TaxId:111955] [189061] (2 PDB entries)
  8. 2890271Domain d2pjkc_: 2pjk C: [304350]
    automated match to d3iwta_
    complexed with gol, mg, na, peg, trs

Details for d2pjkc_

PDB Entry: 2pjk (more details), 1.9 Å

PDB Description: Structure of hypothetical molybdenum cofactor biosynthesis protein B from Sulfolobus tokodaii
PDB Compounds: (C:) 178aa long hypothetical molybdenum cofactor biosynthesis protein B

SCOPe Domain Sequences for d2pjkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pjkc_ c.57.1.0 (C:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
pkslnfyvitistsryekllkkepivdesgdiikqllienghkiigyslvpddkikilka
ftdalsidevdviistggtgysptditvetirklfdreiegfsdvfrlvsfndpevkaaa
yltkasagiigkkivyllpgspdavklalkelilpevghlvylvrs

SCOPe Domain Coordinates for d2pjkc_:

Click to download the PDB-style file with coordinates for d2pjkc_.
(The format of our PDB-style files is described here.)

Timeline for d2pjkc_: