Lineage for d2p6pa1 (2p6p A:1-378)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517892Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2517893Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2518430Family c.87.1.13: UrdGT2-like [310622] (2 proteins)
    Pfam PF06722
  6. 2518439Protein dTDP-D-olivose-transferase UrdGT2 [310722] (1 species)
  7. 2518440Species Streptomyces fradiae [TaxId:1906] [310969] (1 PDB entry)
  8. 2518441Domain d2p6pa1: 2p6p A:1-378 [304327]
    Other proteins in same PDB: d2p6pa2, d2p6pb2
    complexed with gol

Details for d2p6pa1

PDB Entry: 2p6p (more details), 1.88 Å

PDB Description: X-ray crystal structure of C-C bond-forming dTDP-D-Olivose-transferase UrdGT2
PDB Compounds: (A:) glycosyl transferase

SCOPe Domain Sequences for d2p6pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p6pa1 c.87.1.13 (A:1-378) dTDP-D-olivose-transferase UrdGT2 {Streptomyces fradiae [TaxId: 1906]}
mrilfvaagspatvfalaplataarnaghqvvmaanqdmgpvvtgvglpavattdlpirh
fittdregrpeaipsdpvaqarftgrwfarmaasslprmldfsrawrpdlivggtmsyva
pllalhlgvpharqtwdavdadgihpgadaelrpelselglerlpapdlfidicppslrp
anaaparmmrhvatsrqcplepwmytrdtrqrvlvtsgsrvakesydrnfdflrglakdl
vrwdvelivaapdtvaealraevpqarvgwtpldvvaptcdllvhhaggvstltglsagv
pqllipkgsvleaparrvadygaaiallpgedsteaiadscqelqakdtyarraqdlsre
isgmplpatvvtaleqla

SCOPe Domain Coordinates for d2p6pa1:

Click to download the PDB-style file with coordinates for d2p6pa1.
(The format of our PDB-style files is described here.)

Timeline for d2p6pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p6pa2