Lineage for d2oy6c_ (2oy6 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711822Species Todarodes pacificus [TaxId:6637] [189005] (4 PDB entries)
  8. 2711827Domain d2oy6c_: 2oy6 C: [304311]
    automated match to d3i5fc_
    complexed with adp, mg

Details for d2oy6c_

PDB Entry: 2oy6 (more details), 3 Å

PDB Description: Crystal structure of Squid Mg.ADP myosin S1
PDB Compounds: (C:) Myosin catalytic light chain LC-1

SCOPe Domain Sequences for d2oy6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oy6c_ a.39.1.0 (C:) automated matches {Todarodes pacificus [TaxId: 6637]}
sqltkdeieevrevfdlfdfwdgrdgdvdaakvgdllrclgmnpteaqvhqhggtkkmge
kaykleeilpiyeemsskdtgtaadefmeafktfdregqglissaeirnvlkmlgerite
dqcndiftfcdiredidgnikyedlmkkvmagpfpdksd

SCOPe Domain Coordinates for d2oy6c_:

Click to download the PDB-style file with coordinates for d2oy6c_.
(The format of our PDB-style files is described here.)

Timeline for d2oy6c_: