SCOPe 2.08: Domain d2ovkc_: 2ovk C:

Lineage for d2ovkc_ (2ovk C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Todarodes pacificus [TaxId:6637] [189005] (4 PDB entries)

8. Domain d2ovkc_: 2ovk C: [304309]
   automated match to d3i5fc_
   complexed with ca, mli

Details for d2ovkc_

PDB Entry: 2ovk, 2.6 Å

PDB Description: Crystal structure of Rigor-like Squid Myosin S1

PDB Compounds: (C:) Myosin catalytic light chain LC-1, mantle muscle

SCOPe Domain Sequences for d2ovkc_:

Sequence; same for both SEQRES and ATOM records:

>d2ovkc_ a.39.1.0 (C:) automated matches {Todarodes pacificus [TaxId: 6637]}
sqltkdeieevrevfdlfdfwdgrdgdvdaakvgdllrclgmnpteaqvhqhggtkkmge
kaykleeilpiyeemsskdtgtaadefmeafktfdregqglissaeirnvlkmlgerite
dqcndiftfcdiredidgnikyedlmkkvmagpfpd

Timeline for d2ovkc_:

• d2ovkc_ first appeared in SCOPe 2.06
  
• d2ovkc_ appears in SCOPe 2.07