Lineage for d2oufa_ (2ouf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739286Fold a.292: HP0242-like [158751] (1 superfamily)
    multihelical; intertwined homodimer of four-helical subunits, forming catenated triangular ring-like structures; pseudo knot
  4. 2739287Superfamily a.292.1: HP0242-like [158752] (1 family) (S)
    automatically mapped to Pfam PF09442
  5. 2739288Family a.292.1.1: HP0242-like [158753] (1 protein)
    Pfam PF09442; DUF2018
  6. 2739289Protein Hypothetical protein HP0242 [158754] (1 species)
  7. 2739290Species Helicobacter pylori [TaxId:210] [158755] (4 PDB entries)
    Uniprot O25025 1-93! Uniprot O25025 13-92
  8. 2739291Domain d2oufa_: 2ouf A: [304307]
    automated match to d2bo3a1

Details for d2oufa_

PDB Entry: 2ouf (more details), 2 Å

PDB Description: Crystal structure of protein HP0242 from Helicobacter pylori at 2.0 A resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2oufa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oufa_ a.292.1.1 (A:) Hypothetical protein HP0242 {Helicobacter pylori [TaxId: 210]}
npldkwndiifhaskklskkelerllellalletfiekedleekfesfakalrideelqq
kiesrktdiviqsmanilsg

SCOPe Domain Coordinates for d2oufa_:

Click to download the PDB-style file with coordinates for d2oufa_.
(The format of our PDB-style files is described here.)

Timeline for d2oufa_: