Lineage for d2ot6a_ (2ot6 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2583364Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 2583365Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 2583391Protein automated matches [192457] (4 species)
    not a true protein
  7. 2583406Species Vigna sinensis [311235] (1 PDB entry)
  8. 2583407Domain d2ot6a_: 2ot6 A: [304305]
    automated match to d1bbia_

Details for d2ot6a_

PDB Entry: 2ot6 (more details), 2.5 Å

PDB Description: Crystal Structure of a Bowman-Birk Inhibitor from Vigna Unguiculata Seeds
PDB Compounds: (A:) trypsin inhibitor

SCOPe Domain Sequences for d2ot6a_:

Sequence, based on SEQRES records: (download)

>d2ot6a_ g.3.13.1 (A:) automated matches {Vigna sinensis}
pccdscvctksippqchctnirlnschsgcksclctasapgscrcldianfcykpck

Sequence, based on observed residues (ATOM records): (download)

>d2ot6a_ g.3.13.1 (A:) automated matches {Vigna sinensis}
pccdscvctksippqchctnirlnschsgcksclctasgscrcldianfcykpck

SCOPe Domain Coordinates for d2ot6a_:

Click to download the PDB-style file with coordinates for d2ot6a_.
(The format of our PDB-style files is described here.)

Timeline for d2ot6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ot6b_