Lineage for d2ospe_ (2osp E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422468Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2422469Superfamily b.76.1: Outer surface protein [51087] (1 family) (S)
    21 stranded sheet partly folded upon itself at the ends
  5. 2422470Family b.76.1.1: Outer surface protein [51088] (3 proteins)
  6. 2422471Protein Outer surface protein A [51089] (1 species)
  7. 2422472Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [51090] (3 PDB entries)
  8. 2422474Domain d2ospe_: 2osp E: [304303]
    Other proteins in same PDB: d2ospa1, d2ospa2, d2ospc1, d2ospc2
    automated match to d1ospo_

Details for d2ospe_

PDB Entry: 2osp (more details), 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2
PDB Compounds: (E:) protein (outer surface protein a)

SCOPe Domain Sequences for d2ospe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ospe_ b.76.1.1 (E:) Outer surface protein A {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
sldeknsvsvdlpgemkvlvskeknkdgkydliatvdklelkgtsdknngsgvlegvkad
kckvkltisddlgqttlevfkedgktlvskkvtskdkssteekfnekgevsekiitradg
trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgevsveln
dtdssaatkktaawnsgtstltitvnskktkdlvftkentitvqqydsngtklegsavei
tkldeiknalk

SCOPe Domain Coordinates for d2ospe_:

Click to download the PDB-style file with coordinates for d2ospe_.
(The format of our PDB-style files is described here.)

Timeline for d2ospe_: