| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d2ospa2: 2osp A:108-214 [304300] Other proteins in same PDB: d2ospa1, d2ospc1, d2ospe_, d2ospf_ automated match to d1eapa2 |
PDB Entry: 2osp (more details), 2.68 Å
SCOPe Domain Sequences for d2ospa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ospa2 b.1.1.0 (A:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvdwkidgserqngvlnswtdqd
skdstysmsstltlskadyerhnsyaceathktstspvvksfnrnex
Timeline for d2ospa2:
View in 3DDomains from other chains: (mouse over for more information) d2ospc1, d2ospc2, d2ospe_, d2ospf_ |