Lineage for d2ospa2 (2osp A:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760338Domain d2ospa2: 2osp A:108-214 [304300]
    Other proteins in same PDB: d2ospa1, d2ospc1, d2ospe_, d2ospf_
    automated match to d1eapa2

Details for d2ospa2

PDB Entry: 2osp (more details), 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2
PDB Compounds: (A:) protein (hybridoma antibody la2 (light chain))

SCOPe Domain Sequences for d2ospa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ospa2 b.1.1.0 (A:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvdwkidgserqngvlnswtdqd
skdstysmsstltlskadyerhnsyaceathktstspvvksfnrnex

SCOPe Domain Coordinates for d2ospa2:

Click to download the PDB-style file with coordinates for d2ospa2.
(The format of our PDB-style files is described here.)

Timeline for d2ospa2: