Lineage for d2ospa1 (2osp A:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744717Domain d2ospa1: 2osp A:1-107 [304299]
    Other proteins in same PDB: d2ospa2, d2ospc2, d2ospe_, d2ospf_
    automated match to d1eapa1

Details for d2ospa1

PDB Entry: 2osp (more details), 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2
PDB Compounds: (A:) protein (hybridoma antibody la2 (light chain))

SCOPe Domain Sequences for d2ospa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ospa1 b.1.1.1 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspsslsatlggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgnps
rfsgsgsgrdysfsisnleaediaiyyclqydnlqrtfgggtkveik

SCOPe Domain Coordinates for d2ospa1:

Click to download the PDB-style file with coordinates for d2ospa1.
(The format of our PDB-style files is described here.)

Timeline for d2ospa1: